PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027524m
Common NameCARUB_v10027524mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 303aa    MW: 33750.9 Da    PI: 5.1589
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027524mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl
  Carubv10027524m 14 KGAWTPEEDQKLIAYLQLHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.54e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eEd+ +++++++ G++ W++Ia+ +  gRt++++k++w++ 
  Carubv10027524m  67 RGEFSPEEDDTIIKLHALKGNK-WAAIAASLA-GRTDNEIKNYWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.153961IPR017930Myb domain
SuperFamilySSF466891.1E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001671.10E-91661No hitNo description
PROSITE profilePS5129424.69262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2565117IPR009057Homeodomain-like
SMARTSM007178.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1467112IPR001005SANT/Myb domain
CDDcd001679.79E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000162Biological Processtryptophan biosynthetic process
GO:0002213Biological Processdefense response to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0009759Biological Processindole glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MVRTPCCKEE GIKKGAWTPE EDQKLIAYLQ LHGEGGWRTL PEKAGLKRCG KSCRLRWANY  60
LRPDIKRGEF SPEEDDTIIK LHALKGNKWA AIAASLAGRT DNEIKNYWNT NLKKRIKQKK  120
GLDPIPITHK SINSSTGQNA IEPINNNKPV RSSGSARLLN RVASKYAAEF NRDLLTGLIS  180
GNRTVFGDSQ NPSGKIDPRD STLLNKVAET SVYINSSTLS DISDNCFNEF LSNEEISDNC  240
FNEFLSNEKI SDDFMYTTID NIEFMEELKG ILSGSGAEVV ENSSDEVNAA DEMEFIIGCW  300
NE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111119LKKRIKQKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196421e-177AY519642.1 Arabidopsis thaliana MYB transcription factor (At5g60890) mRNA, complete cds.
GenBankBT0303261e-177BT030326.1 Arabidopsis thaliana unknown protein (At5g60890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281446.10.0hypothetical protein CARUB_v10027524mg
SwissprotO643991e-141MYB34_ARATH; Transcription factor MYB34
TrEMBLR0GCF40.0R0GCF4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__2056__AT5G60890.11e-151(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-142myb domain protein 34